DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and SEC14L3

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:291 Identity:61/291 - (20%)
Similarity:109/291 - (37%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNELPARMAQDIEALRDWV------LKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQ 77
            :.:|..:.|:.:...|:.|      |..|      ||.|||.:||...|.|::::....::...:
Human     5 VGDLSPKQAETLAKFRENVQDVLPALPNP------DDYFLLRWLRARNFDLQKSEALLRKYMEFR 63

  Fly    78 RSI----------PEVFNERR----LATD----PQVLDIVRMGVLLQIPMDADDPGPRVTIIRAG 124
            :::          |||..:..    ...|    |...||:.       |:|     |:..:....
Human    64 KTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIG-------PLD-----PKGLLFSVT 116

  Fly   125 SYDTSKHKFQDIIRVGSMFGEIMMFEDDNAT------VSGYVEIMDMAGVTGSHLFALQPQLLSK 183
            ..|..|.|.:|..|:        :.|.|..|      :...|.|.|..|:...|.:....::..:
Human   117 KQDLLKTKMRDCERI--------LHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQE 173

  Fly   184 FSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSD--PAAIYELVRRKYLP 246
            |....:|..|...|.:..:.....|..|:|.::.|.....:.:|.|..:  ...:.:|:..:.||
Human   174 FFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELP 238

  Fly   247 QEYGGT----GGN---LQDISHTMEAKLSSY 270
            .::|||    .||   |..|::..|...|.|
Human   239 AQFGGTLTDPDGNPKCLTKINYGGEIPKSMY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/50 (28%)
SEC14 96..252 CDD:238099 32/163 (20%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 14/51 (27%)
SEC14 76..245 CDD:214706 38/188 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.