DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and cgr-1

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:231 Identity:48/231 - (20%)
Similarity:83/231 - (35%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNELPARMAQDIEALR----DWVLKQPHLRACTDDQF-LLAFLRGTKFSLERAKEKFDRFYTLQR 78
            ||||.|.....|..||    |.:...|..    |..| ||.:|.|..:.::....|..  |.::.
 Worm    10 LNELTAHQKDKIAELRSKTKDILATYPEY----DTDFSLLRWLMGWDYKIDVIVPKMR--YAVET 68

  Fly    79 SIPEVFNERRLATDPQV-LDIVRMGVLLQ---------------IPMDADDPGPRVTIIRAGSYD 127
            .:....|.::..:..|: .||..|..:.:               :.|.|.......|:::||   
 Worm    69 LVNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLVKAG--- 130

  Fly   128 TSKHKFQDIIRVGSM-FGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEA 191
            .:...||..|....| |..|...|.:.....|.:.|||:.|.:...|:....::.....|.....
 Worm   131 PTSQLFQLCISETEMSFKIIRQTEQETERKMGVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNI 195

  Fly   192 MPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRI 227
            .|...:.|:.||.||.....:..:.....::.:.::
 Worm   196 FPDFARRIYIINCPAMMSAVYAMVSPVLSSQTREKV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 12/49 (24%)
SEC14 96..252 CDD:238099 28/148 (19%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 26/144 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.