DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and F18A11.2

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:197 Identity:47/197 - (23%)
Similarity:74/197 - (37%) Gaps:55/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 IPMDA-----DDPGPRVTIIRAGSYDTS-------KHKFQDIIRVGSMFG---EIMMFEDDNATV 156
            :|:|.     .|....:...|.|..|.|       .|||.. |::..|.|   :::..|......
 Worm    80 VPIDVIGQNHQDDNKVLMFERTGKIDISGLVDNVLMHKFMQ-IKLKMMEGVHQKVVAAERKTGRQ 143

  Fly   157 SGYVEIMDMAGV----------TGSH------LFALQPQLLSKFSTYADEAMPTRQKGIHFINVP 205
            ||.:.|||:.|:          ||.:      ||...||||.|               |..:|.|
 Worm   144 SGGLFIMDLDGISFSPKLISVLTGPYRIMWGTLFDHYPQLLQK---------------IIIVNAP 193

  Fly   206 AAFETGFNSLRSFFPAKIKSRISVSSDPA--AIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLS 268
            :.......:...|.|...|.:|.::|:||  ||.:...:.:||.:.||      |:..|....::
 Worm   194 SFVNVLHQACSPFLPEDYKEKIVITSEPAIGAIQKHADKCFLPSDLGG------DLEKTTSLPMA 252

  Fly   269 SY 270
            .:
 Worm   253 PF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024
SEC14 96..252 CDD:238099 44/177 (25%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 46/185 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.