Sequence 1: | NP_001285685.1 | Gene: | CG31636 / 318865 | FlyBaseID: | FBgn0051636 | Length: | 313 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496771.1 | Gene: | F18A11.2 / 174945 | WormBaseID: | WBGene00008929 | Length: | 388 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 47/197 - (23%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 55/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 IPMDA-----DDPGPRVTIIRAGSYDTS-------KHKFQDIIRVGSMFG---EIMMFEDDNATV 156
Fly 157 SGYVEIMDMAGV----------TGSH------LFALQPQLLSKFSTYADEAMPTRQKGIHFINVP 205
Fly 206 AAFETGFNSLRSFFPAKIKSRISVSSDPA--AIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLS 268
Fly 269 SY 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31636 | NP_001285685.1 | CRAL_TRIO_N | 27..72 | CDD:215024 | |
SEC14 | 96..252 | CDD:238099 | 44/177 (25%) | ||
F18A11.2 | NP_496771.1 | SEC14 | 72..244 | CDD:214706 | 46/185 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |