DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and H41C03.1

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:257 Identity:48/257 - (18%)
Similarity:86/257 - (33%) Gaps:73/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDQF-LLAFLRGTKFSLERAKE------KFDRFYTLQRSIPEVFNERRL------------ATDP 93
            |..| ||.:.:|..|..:.|..      :|.::|.|...:..|.:...|            ..|.
 Worm    25 DTDFNLLRWAQGYGFDKDEALAELRRHLRFRQYYDLDNILTNVPDHPILKKYFPLGLVGETGKDN 89

  Fly    94 QVL------DIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDD 152
            |:|      .|..||:|..:.:              ..:...:.|||:     .|...:...|..
 Worm    90 QLLVIECAGRIDLMGILKSVHL--------------SDFLIQRFKFQE-----KMLAAMNEMERK 135

  Fly   153 NATVSGYVEIMDMAG----------VTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAA 207
            ..|....:.|:|:.|          |||       |..:...|.|.  |.|.....:..||.|:.
 Worm   136 YGTQCSVIYILDLEGLKFDPALISIVTG-------PYRILWASVYT--AYPEWINTLFLINAPSF 191

  Fly   208 FETGFNSLRSFFPAKIKSRISVSSD----PAAIYELVRRKYLPQEYGGT------GGNLQDI 259
            ....:.::....|.:.::::.:.|.    ..::.:......:|:.:|||      .|..:||
 Worm   192 MTLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGGTLVDKNGDGMCRDI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 8/30 (27%)
SEC14 96..252 CDD:238099 29/175 (17%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 34/200 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.