DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CLVS2

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:241 Identity:72/241 - (29%)
Similarity:122/241 - (50%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQP---HLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRS 79
            ||||.|..:.|||:.:||.|:.:|   .||  |||.|:|.|||..||....|.....:::..::.
Human    19 ELNENPDTLHQDIQEVRDMVITRPDIGFLR--TDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQ 81

  Fly    80 IPEVFNERRLATDPQVLDIVRMGVLLQIP---MDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGS 141
            ..::|...: ||||.:...::.|    .|   .:.|..|.::.::.|.::|.|::...||:|...
Human    82 NLDMFKSFK-ATDPGIKQALKDG----FPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAIL 141

  Fly   142 MFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPA 206
            :..|.|: ||....|:|:|.|:|.:..|......|.|.:|........::.|.|..||||:|.|.
Human   142 LSLEAMI-EDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPW 205

  Fly   207 AFETGFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGG 251
            .....:..:|.|...|.:.||.: .::..::::|:..:.||.|:||
Human   206 YIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 20/47 (43%)
SEC14 96..252 CDD:238099 42/160 (26%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 20/47 (43%)
SEC14 106..251 CDD:238099 38/145 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.