DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:296 Identity:67/296 - (22%)
Similarity:110/296 - (37%) Gaps:88/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDQFLLAFLRGTKFSLERA-----------KEK-FDRFYTLQRSIPEVFNE----RRLATD---- 92
            ||.|||.:||...|.|:::           |:| .|:..:.|.  |||..:    .|...|    
  Rat    34 DDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIISWQP--PEVIQQYLSGGRCGYDLDGC 96

  Fly    93 PQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNAT-- 155
            |...||:.       |:||          :...:..||   ||::|......|:::.|..:.|  
  Rat    97 PVWYDIIG-------PLDA----------KGLLFSASK---QDLLRTKMRDCELLLQECTHQTAK 141

  Fly   156 ----VSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLR 216
                :.....|.|..|:...||:....:...:|.|..:|..|...|.:..:..|..|...:|.::
  Rat   142 LGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIK 206

  Fly   217 SFFPAKIKSRISVSSDPAAIYELVRRKY-----LPQEYGGT----GGNLQDISHTMEAKLSSYGP 272
            .|.....:.:|.|.   .|.::.|..|:     ||.|||||    .||                |
  Rat   207 PFLSEDTRKKIMVL---GANWKEVLLKHISPDQLPVEYGGTMTDPDGN----------------P 252

  Fly   273 YFRESQNFGAN--------DKLREFGDH----KRGN 296
            ..:...|:|.:        |::::..:|    .||:
  Rat   253 KCKSKINYGGDIPKQYYVRDQVKQQYEHSVQISRGS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 11/35 (31%)
SEC14 96..252 CDD:238099 37/166 (22%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 9/24 (38%)
SEC14 76..244 CDD:214706 43/192 (22%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.