DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:244 Identity:56/244 - (22%)
Similarity:103/244 - (42%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRF--YTLQRSIPEVFNERR 88
            :|:..|.|:|.:...|.    .||.|||.:||...|.|:::::...:.  :..|:::.::...:.
Mouse    16 LARFRETLQDLLPTLPK----ADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQNLDQILTWQA 76

  Fly    89 LATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYD-------TSKHKFQDIIRVGSMFGEI 146
                |:|:.:...|.|    ...|..|..|.....|:.|       .||   ||:||......|:
Mouse    77 ----PEVIQLYDSGGL----SGYDYEGCPVWFDIIGTMDPKGLFMSASK---QDMIRKRIKVCEM 130

  Fly   147 MMFEDD------NATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVP 205
            ::.|.:      ...:...|.:.||.|::..||:....::..:|....:...|...|.:..|..|
Mouse   131 LLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAP 195

  Fly   206 AAFETGFNSLRSFFPAKIKSRISV--SSDPAAIYELVRRKYLPQEYGGT 252
            ..|...||.::||...:.:.:|.:  .:....:.:.|....||.|:|||
Mouse   196 KLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/44 (32%)
SEC14 96..252 CDD:238099 37/170 (22%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 14/46 (30%)
SEC14 77..244 CDD:214706 39/173 (23%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.