DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and clvs2

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_017949794.1 Gene:clvs2 / 100496225 XenbaseID:XB-GENE-1005080 Length:327 Species:Xenopus tropicalis


Alignment Length:241 Identity:73/241 - (30%)
Similarity:124/241 - (51%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQP---HLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRS 79
            ||||.|..:.|||:.:||.|:.:|   .||  |||.|:|.|||..||:...|.....:::..::.
 Frog    19 ELNENPDTLHQDIQEVRDMVITRPDIGFLR--TDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ 81

  Fly    80 IPEVFNERRLATDPQVLDIVR---MGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGS 141
            ..::|...: ||||.:...::   .|||..:    |..|.::.::.|.::|.|::...||:|...
 Frog    82 NLDMFKNFK-ATDPGIKQGLKDGFPGVLSNL----DHFGRKILVLFAANWDQSRYTLVDILRAIL 141

  Fly   142 MFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPA 206
            :..|.|: ||....|:|:|.|:|.:..|......|.|.:|........::.|.|..||||:|.|.
 Frog   142 LSLEAMI-EDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPW 205

  Fly   207 AFETGFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGG 251
            .....:..:|.|...|.:.||.: .::..::::|:..:.||.|:||
 Frog   206 YIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 20/47 (43%)
SEC14 96..252 CDD:238099 43/160 (27%)
clvs2XP_017949794.1 CRAL_TRIO_N 29..75 CDD:215024 20/47 (43%)
SEC14 106..251 CDD:238099 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.