DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31627 and CG12609

DIOPT Version :9

Sequence 1:NP_724314.2 Gene:CG31627 / 318860 FlyBaseID:FBgn0051627 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_728194.1 Gene:CG12609 / 32862 FlyBaseID:FBgn0030952 Length:324 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:73/177 - (41%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SPSPEFMKTAKAKLKLIALYEDHKCLWNQRNKDFFNFELKDRIWDAIADEMKADSPSGFWKHMIH 134
            |...||      .|:|:.||.:..|||......:.:.::|...|:.||.::.:...:.|.:..:.
  Fly    26 SQEKEF------NLRLVDLYREQPCLWKITLPAYKDADMKRSSWEKIASQLGSHLSAEFIRCRMR 84

  Fly   135 KLRYKV---EMERIQEQGAKFSGESPQPKLFYSDNLLFLNHMFDREGGKPPREIPMHLKPSGPTL 196
            .:||::   :::.|:.|.....|:.|: |.:|.|...||    ::|.|....:            
  Fly    85 NMRYQLNVYKLQMIEYQMTSGKGKPPE-KPYYVDRFAFL----EQEDGAEESD------------ 132

  Fly   197 EKNPSRNLRHVQEKRKRTPIREKMASLEKLRNLQNSKFVLSRDAFQK 243
              |...|   ...|::..|..|:.|.|....||::.....|.||..|
  Fly   133 --NQQSN---ANAKKQNIPRSERFAKLWSDFNLKSMTKRESTDASSK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31627NP_724314.2 MADF_DNA_bdg 85..170 CDD:287510 20/87 (23%)
CG12609NP_728194.1 MADF_DNA_bdg 35..122 CDD:287510 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA9V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.