DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and AT2G28240

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_180391.2 Gene:AT2G28240 / 817370 AraportID:AT2G28240 Length:660 Species:Arabidopsis thaliana


Alignment Length:361 Identity:89/361 - (24%)
Similarity:123/361 - (34%) Gaps:117/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALASADVSHLNLGSGYSYNKP-----TPTFNIPSAPAPAYLPPVQEVI--------------SAP 57
            ||.|..|.:..|.:.|....|     |.|..:.:..:..:....|:.:              |..
plant   257 ALRSLVVMNSLLANAYKSTCPVKSAATDTATVRAPRSSQHSTQQQQAVQTNRHMNSTAPPRPSVT 321

  Fly    58 APAPVYSAPAPAPVYSAPAPAPVYSAPAPAP---VSEYLPPVQDIPAPAPVYSAPAPAPV----- 114
            |..|:.||..|.|  |..|..|:.|...|.|   .:|..||  ::.||.|..:.|.|:|:     
plant   322 AAEPMNSAAPPRP--SVTAAEPMNSTAPPRPSVTAAEATPP--NLSAPLPHCNTPQPSPISQQAA 382

  Fly   115 -------YSAPAPAPVYSA--------------PAPAPEY-------------LP---------- 135
                   .|...|.|..:|              |.|.|:.             ||          
plant   383 VESNTQMQSTALPRPSVTAEARPLHQPHSNTSQPRPIPQQALAQSNTNITSTALPRPSITAEARL 447

  Fly   136 ---PVQDIPAPAPAP----------VYSAPAPAPVYSAPAPAPVY----SAPAPAPVSEYLPPVQ 183
               |..:.|.|.|.|          :.|...|.|:.:|.|| |::    .||.|.|:|:. |.||
plant   448 LHQPHSNTPQPRPIPQKALVQANTDINSTALPRPLVTAEAP-PLHQSSCKAPQPKPISQQ-PAVQ 510

  Fly   184 D---------IPAPAPVYSA-PAPAPVYSAPAPAPVYSAPAPAPEYLPPVQDLPAPAP------- 231
            .         :|.|:....| |...|....|.|.|| |.| ||.:....:...|.|.|       
plant   511 SKTDIINSTALPRPSVTTEARPLHQPRSKTPQPKPV-SQP-PAKQSNTEINSTPHPRPSVTSKAI 573

  Fly   232 ---APVYSAPAPAPAPVYSAPAPAPVYSAPAPAPVY 264
               :|..:.|.|.|.|:.|...|.....|.|| ||:
plant   574 SLQSPPCNTPQPRPPPLISNHTPTSYQPASAP-PVH 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 65/269 (24%)
AT2G28240NP_180391.2 PHA03247 <314..636 CDD:223021 79/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.