DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and Pou2af1

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001103069.1 Gene:Pou2af1 / 690528 RGDID:1594728 Length:256 Species:Rattus norvegicus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:89/231 - (38%) Gaps:26/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YNKPTPTFNIPSAPAP----AYLPPVQEVISAP-APAPVYSAPAPAPVYSAPAPAPVYSAPAPAP 88
            :.|.|.:...|:.|.|    ....||:|::... ....|.:|..||.|.....|...||...|:.
  Rat     3 WQKSTASEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGTAGPPAAVVLPHQPLATYSTVGPSC 67

  Fly    89 VSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYS-AP-APAPEYLPPVQDIPAPAPAPVYSA 151
            :.      .::.||.........|...|.||||.:.. || .|..||:.. :.:..|..|.:|..
  Rat    68 LD------MEVSAPTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEYVSH-EAVSCPYSADMYVQ 125

  Fly   152 PAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPA-PAPVYSAPAPAPVYSAPAP 215
            |. .|.|:...|:.|.:..:|..::...|.....||..|....|. .||:...|.|.|:.:.|..
  Rat   126 PV-CPSYTVVGPSSVLTYASPPLITNVTPRSTATPAVGPQLEGPEHQAPLTYFPWPQPLSTLPTS 189

  Fly   216 APEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAP 251
            :.:|.|         |||..|.|.....|: |.|.|
  Rat   190 SLQYQP---------PAPTLSGPQFVQLPI-SIPEP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 46/180 (26%)
Pou2af1NP_001103069.1 PD-C2-AF1 7..255 CDD:286403 60/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.