DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG11350

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:402 Identity:145/402 - (36%)
Similarity:170/402 - (42%) Gaps:128/402 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFAVCA-IALASADVSHLNLGSGY-------------SYNKPTPTFNI-PSAPAPAYLPPV 50
            ||.|:|  || ||..:||||||. .|.|             ||:.|:.:::: .|||..:|..||
  Fly     1 MKFFLF--CAFIAAVAADVSHLP-SSQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPV 62

  Fly    51 QEVISAPAPAPVYSAPAPAPVYSAP-----APAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPA 110
            :...|..|.||..|..|||..|:||     |||..|:|.|.||...|..|.|...|||..|:|.|
  Fly    63 ESSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAA 127

  Fly   111 PAPVYSAPAPAPVYSAP---------APAPEYLPPVQDIPAPAPAPV--YSAPAPAPVYSAPAPA 164
            .||..|..|||..||||         |||..|..|.|...|.|.||.  |||||.:...:|..||
  Fly   128 SAPAVSYAAPAQSYSAPAATYTAAASAPAVTYAAPAQTYTAAASAPAVSYSAPAESYETAASEPA 192

  Fly   165 PVYSA--------------------------------PAPAPVSEYLPPVQDIPAPAPVYSAPAP 197
            ..:||                                .|.||.||||||...  ||||||.:.|.
  Fly   193 HTFSANDGYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAAS--APAPVYQSAAS 255

  Fly   198 APVYSAPAPAPVYSAPA-----------------------------------------------P 215
            ||..|..|||..|||||                                               |
  Fly   256 APAVSYAAPAQTYSAPAVSYAEPAESYETAASAPAHSFSSNDGYRYKTHKRVVLRRHRRDVSHLP 320

  Fly   216 APEYLPPVQDLPAPAPAPVYSAPA---PAPAPVYSAPAPAPVYSAPAPAPVYSAPAPVES----- 272
            :.:||||.    |.||||||||||   .|||..|:|.|.||..|..|||..|||||...:     
  Fly   321 SNDYLPPA----ASAPAPVYSAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAASA 381

  Fly   273 -GYQYNVPAKRF 283
             ...|:.|::.:
  Fly   382 PAVSYSAPSQSY 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 91/271 (34%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 0/16 (0%)
GYR 296..313 CDD:128953 0/16 (0%)
GYR 438..455 CDD:128953
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.