DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG10953

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001261042.1 Gene:CG10953 / 36941 FlyBaseID:FBgn0034204 Length:278 Species:Drosophila melanogaster


Alignment Length:319 Identity:165/319 - (51%)
Similarity:178/319 - (55%) Gaps:84/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFAVCAIALASADVSHLNLGSGYSYNKPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSA 65
            ||..|.|...:|.|..|||||    ||.|:        |.||||.|         .|||||||. 
  Fly     1 MKFLVVAFAVLACAYGDVSHL----GYDYS--------PPAPAPVY---------QPAPAPVYQ- 43

  Fly    66 PAPAPVYSAPAPAP-VYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAP 129
            |||||||. ||||| |..|||||||      |...||||||. .||||||.:...|||:   ..|
  Fly    44 PAPAPVYQ-PAPAPVVIPAPAPAPV------VIPAPAPAPVV-IPAPAPVKTYVPPAPI---SIP 97

  Fly   130 APEYLPPVQDIPAP--APAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVY 192
            ||.|.|    .|||  .|||||. |||||: |.|||||: ..||||||:.|:||.   |||||||
  Fly    98 APVYQP----APAPIRIPAPVYQ-PAPAPI-SIPAPAPI-EIPAPAPVNTYIPPA---PAPAPVY 152

  Fly   193 S-APAPAPVYSAPAPAPVYSAPAPAPEYLP-----PVQDLPAPAPAP-VYSAPAPA-----PAPV 245
            . ||||.|| |.|||||||. |||||..:|     ||. :||||||| |..||||.     |||:
  Fly   153 QPAPAPIPV-SIPAPAPVYQ-PAPAPVVIPAPAPAPVV-IPAPAPAPVVIPAPAPVKSYVPPAPI 214

  Fly   246 YSAPAPAPVY-----SAPAPAPVYS-APAPV----------------ESGYQYNVPAKR 282
             |.|||||||     |.|||||||. |||||                ..||:|....:|
  Fly   215 -SIPAPAPVYQPAPISIPAPAPVYQPAPAPVYQPTNTQVLEEIEPASNDGYRYKTVRRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 104/185 (56%)
CG10953NP_001261042.1 FLO_LFY 23..>60 CDD:279962 28/55 (51%)
GYR 261..278 CDD:128953 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.