DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG11584

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:440 Identity:179/440 - (40%)
Similarity:195/440 - (44%) Gaps:194/440 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YNKPTPTFNIPSAPAPAYLP--PVQEVISAPAPAPVYSAPAP-----APVYSAPAPAPVYSAPAP 86
            |..|.|.....:|...||||  |||:.:  |||.||.:..||     ...|:|||.|||   |||
  Fly   124 YEAPKPVIATQTAAKNAYLPPAPVQQFV--PAPEPVVANIAPQQETITTTYNAPAAAPV---PAP 183

  Fly    87 APVSEYLPPVQD----------IPAPAPV----YSAPAPAPV----YSAPAP----------APV 123
            ||::..:|.||:          :|||||.    |||||||||    ||||||          |||
  Fly   184 APIAIPVPAVQEQHQVIQQTYSVPAPAPAVQQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPV 248

  Fly   124 -------YSAPAPAPE---YLPPVQDI------PAPAPAPV----YSAPAPA--PVYSAPAPAPV 166
                   ||||||..:   |..|...:      ||||||||    |||||||  ..|||||||||
  Fly   249 QAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPV 313

  Fly   167 ----YSAPAPAPVSEY---LPPVQD---------IPAPAPV----YSAPAP-------------- 197
                ||||||||...|   .|.||:         .||||||    ||.|||              
  Fly   314 VQQTYSAPAPAPQQTYSAPAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQ 378

  Fly   198 APV----YSAPAPAPV----YSAPAPAP----EYLPPVQDLP-------APAPAPV----YSAPA 239
            |||    |||||||||    ||||||..    :..|.:|..|       |||||||    |||||
  Fly   379 APVVQQSYSAPAPAPVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSAPA 443

  Fly   240 P-----------------------APAPV--------------------YSAPAPAPV----YSA 257
            |                       |||||                    |||||||||    |||
  Fly   444 PVVQETIQQAPVIQQAPVVQQSYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPAPAPVVQQSYSA 508

  Fly   258 PAPAPV--------------YSAPAPVE--------------SGYQYNVP 279
            ||||||              |:|||||.              |||.|..|
  Fly   509 PAPAPVVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYSYQTP 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 125/279 (45%)
CG11584NP_572941.1 rne <209..408 CDD:236766 94/198 (47%)
rne <329..539 CDD:236766 78/209 (37%)
TFIIA 475..>635 CDD:281188 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.