DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG1368

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_572939.1 Gene:CG1368 / 32361 FlyBaseID:FBgn0030539 Length:186 Species:Drosophila melanogaster


Alignment Length:273 Identity:97/273 - (35%)
Similarity:118/273 - (43%) Gaps:99/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFAVCAIALASADVSHLNLGSGYSYNKPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSAPAP 68
            |:.|....|..:||||||:       |:              ||||||.  |..||:..|||||.
  Fly     3 FLIAFALFACVAADVSHLS-------NE--------------YLPPVQS--SYAAPSVSYSAPAV 44

  Fly    69 APVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPEY 133
            ...|:|||....|.||:    :|||||||       .|||||....|||||....||||:     
  Fly    45 QQTYAAPAIQQSYVAPS----NEYLPPVQ-------TYSAPAVQRTYSAPAVQRTYSAPS----- 93

  Fly   134 LPPVQDIPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPA 198
                  :...||:..||||:.:  |||||....||||:.:                  |||||..
  Fly    94 ------VSYSAPSVSYSAPSVS--YSAPAVQQSYSAPSVS------------------YSAPAVQ 132

  Fly   199 PVYSAPAPAPVYSAPAPAPEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPAPVYSAPAPAPV 263
            ..||||:.:  |||||....|                             .|||..||||:.:  
  Fly   133 QSYSAPSVS--YSAPAVQQSY-----------------------------SAPAVSYSAPSVS-- 164

  Fly   264 YSAPAPVESGYQY 276
            ||||: |:.|.||
  Fly   165 YSAPS-VDVGTQY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 72/176 (41%)
CG1368NP_572939.1 PRK10263 <13..>170 CDD:236669 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.