DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG2962

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_572612.2 Gene:CG2962 / 31952 FlyBaseID:FBgn0030186 Length:376 Species:Drosophila melanogaster


Alignment Length:325 Identity:138/325 - (42%)
Similarity:150/325 - (46%) Gaps:134/325 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SHLNLGSGYSYNKPTPTFNIP-----------SAPAPAYLPPVQEVISAPAP------------A 60
            |..:.||||.|......|.:.           .||.||||||     :.|||            |
  Fly    79 SGASYGSGYGYEAAPQIFKVKVISGGSGGGYGPAPGPAYLPP-----AGPAPSSVKVIKILQESA 138

  Fly    61 PVYSAP--------------APAPV---------------------------------------- 71
            |:.|||              |..||                                        
  Fly   139 PIVSAPLVESAPQIVKVVNVASGPVAGPSFIGGSSVGGGAVSQVIKVVHESHDSGISSGGYSSGG 203

  Fly    72 --------------------YSAPAPAPVYS-----APAPAPVSEYLPPVQDIPAPAPVYSAPAP 111
                                :||||..|.|:     ||..|||:.|||| |:|.||||||:||||
  Fly   204 YSSGGYSSGGATKVVRVIHEHSAPAAGPAYAPIDVPAPVAAPVASYLPP-QEIAAPAPVYAAPAP 267

  Fly   112 APVYSAPAPAPVYSAPAPAPEYLPPVQDIPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVS 176
            ||||:|||||||||||||||.|       .||||||||||||||||||||||||.|||       
  Fly   268 APVYAAPAPAPVYSAPAPAPVY-------SAPAPAPVYSAPAPAPVYSAPAPAPAYSA------- 318

  Fly   177 EYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSA--PAPAPEYLPPVQDLP-APAPAPVYSAP 238
                     ||||||||||||||||:|||||||.|.  |||||.:.|..|.|| ..|||..|..|
  Fly   319 ---------PAPAPVYSAPAPAPVYAAPAPAPVLSVPHPAPAPVFAPEEQSLPIGHAPAQTYGPP 374

  Fly   239  238
              Fly   375  374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 119/269 (44%)
CG2962NP_572612.2 DUF4766 57..189 CDD:292595 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.