DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and CG32248

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_729002.2 Gene:CG32248 / 317938 FlyBaseID:FBgn0052248 Length:182 Species:Drosophila melanogaster


Alignment Length:284 Identity:95/284 - (33%)
Similarity:115/284 - (40%) Gaps:110/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFAVCAIALASADVSHLNLGSGYSYNKPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSA 65
            ||.|:..:..:...:|:       |||:||.|...  ..|||||.:    |:..|||||...|..
  Fly     1 MKFFILTLAVVGCVAAE-------SGYNYNAPRQV--AASAPAPVF----QQAASAPAPVRTYVP 52

  Fly    66 PAPAPVYSAPAPAPVYS-APAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAP 129
            ||||      |.|||.| |||||||:                   |||||:...|     |||||
  Fly    53 PAPA------ASAPVQSFAPAPAPVA-------------------APAPVFQQAA-----SAPAP 87

  Fly   130 APEYLPPVQDIPAPAPAPVYSAPAPAPVYS-APAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYS 193
            |..|:||...:...|     :|.|||||.| ||||     |||||||..:.              
  Fly    88 ARTYVPPAPHVHHHA-----AASAPAPVQSFAPAP-----APAPAPVQSFA-------------- 128

  Fly   194 APAPAPVYSAPAPAPVYSAPAPAPEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPAPVYSAP 258
                             ||||||.|           :..||:.|.|.||:...|.      |.  
  Fly   129 -----------------SAPAPAFE-----------SSGPVFEAAASAPSAARSG------YD-- 157

  Fly   259 APAPVYSAPAPVESGYQYNVPAKR 282
                 ||.||..:.||:|....:|
  Fly   158 -----YSQPAASQQGYKYKTVRRR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 64/178 (36%)
CG32248NP_729002.2 GYR 165..181 CDD:128953 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KYQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.