DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31626 and pou2af1

DIOPT Version :9

Sequence 1:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_009289855.1 Gene:pou2af1 / 103908823 -ID:- Length:248 Species:Danio rerio


Alignment Length:167 Identity:40/167 - (23%)
Similarity:61/167 - (36%) Gaps:34/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 APVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPEYLPPVQDIPA 142
            |...|..|..|:|.:.||......||                      .|:.|..|:.|:     
Zfish    83 AQTTSTTALQPLSHWTPPDCQHHDPA----------------------IPSHADMYVQPI----- 120

  Fly   143 PAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPVYSAPAPA 207
               .|.|:....:|:.:. |.||:::..|....|..:.|..::|..:..| .|...|:.:.|.|.
Zfish   121 ---CPGYTVVGSSPMLTF-AHAPLFTNLATVSTSSSVLPQVEVPDSSLTY-IPWAQPLSTIPGPV 180

  Fly   208 PVYSAPAPAPEYLPPVQDLP--APAPAPVYSAPAPAP 242
            ...|:...||:..|....||  :|.|.|....|..||
Zfish   181 MQASSALSAPQLFPVPLTLPVLSPEPEPPQVEPQQAP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 31/143 (22%)
pou2af1XP_009289855.1 PD-C2-AF1 9..246 CDD:312716 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.