DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and Rpp21

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_080584.1 Gene:Rpp21 / 67676 MGIID:1914926 Length:150 Species:Mus musculus


Alignment Length:182 Identity:36/182 - (19%)
Similarity:64/182 - (35%) Gaps:65/182 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RAISSRMNYLFQASNLMAVGN--QPKLAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPLIPG 75
            |....|:::|:||::.:...|  ...||.:|....:.:..:.::...|:|||:|||.|...||||
Mouse     8 REAFQRLSFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRTLCRSCSSLLIPG 72

  Fly    76 VNTELHVEEGAQEAKTDAQAQSNGAVKTKKKRHRRQRKKPRSRKTGNTNQEESEEQIQESTEQVS 140
            :...                             :|||::...|.|..|                 
Mouse    73 LTCT-----------------------------QRQRRRKGQRWTVQT----------------- 91

  Fly   141 FFLECSLCCGRRSFAANSQRDCWLEQPQS-------------IVQVVSLPKE 179
                |..|...:.|..:.:...|.::|::             :..:..||||
Mouse    92 ----CLTCQRSQRFLNDPKHLLWGDRPEAQLENQADINPSEPLPNIADLPKE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 20/66 (30%)
Rpp21NP_080584.1 Rpr2 13..96 CDD:281961 20/84 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..150 2/28 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006632
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103265
Panther 1 1.100 - - LDO PTHR14742
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1210
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.