DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and rpp21

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001004893.1 Gene:rpp21 / 448235 XenbaseID:XB-GENE-944811 Length:154 Species:Xenopus tropicalis


Alignment Length:168 Identity:36/168 - (21%)
Similarity:67/168 - (39%) Gaps:54/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RMNYLFQASNLMAVGN--QPKLAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPLIPGVNTEL 80
            |:|:|:||::.:...|  ..:||.:|....|.:..:.::...|:|||::|::|...||.||.:.:
 Frog    13 RLNFLYQAAHCVLAQNPENVELARFYCHTERMISKRLVLRQDPSVKRTICKKCSSLLISGVTSTV 77

  Fly    81 HVEEGAQEAKTDAQAQSNGAVKTKKKRHRRQRKKPRSRKTGNTNQEESEEQIQESTEQVSFFLEC 145
                                         ||:|....|||                     .::|
 Frog    78 -----------------------------RQKKLRGQRKT---------------------VVKC 92

  Fly   146 SLCCGRRSFAANSQRDCWLEQPQSIVQVVSLPKEKDER 183
            ..|.....|.:|.....|.|||:::::  :.||...::
 Frog    93 LTCGLTNRFLSNPNYKLWCEQPEALLE--NQPKTDQDK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 20/66 (30%)
rpp21NP_001004893.1 Rpr2 13..96 CDD:377206 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12145
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560813at2759
OrthoFinder 1 1.000 - - FOG0006632
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14742
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1210
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.