DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and rpp21

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001003530.1 Gene:rpp21 / 445136 ZFINID:ZDB-GENE-040801-37 Length:165 Species:Danio rerio


Alignment Length:157 Identity:40/157 - (25%)
Similarity:75/157 - (47%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RMNYLFQASNLMAVGNQP--KLAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPLIPGVNTEL 80
            |:|:|:||::.:...|..  :||.:|....:.:..:.::...|:|||::|::|:..|||||.:.:
Zfish    13 RLNFLYQAAHCVLAQNPENIELARFYCFTQKTISKRLVLRQDPSVKRTICKKCYTLLIPGVTSTV 77

  Fly    81 HVEEG-AQEAKTDAQAQSNGAVK--TKKKRHRRQRKKPRSRKTGNTNQEESEEQIQESTEQVSFF 142
            ..:.| .::.||..:..|.|..|  ....:|:....:|.::....|:|.....  ..||.|..  
Zfish    78 RQKRGKGRQRKTVVRCLSCGLTKRFPNNPKHKLWVDQPEAQLENQTSQGAGPS--SNSTTQGK-- 138

  Fly   143 LECSLCCGRRSFAANSQRDCWLEQPQS 169
             :|....|..|.||.:.......:|:|
Zfish   139 -KCDGSSGSASTAAKTTPTAQTNKPKS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 20/66 (30%)
rpp21NP_001003530.1 Rpr2 13..97 CDD:281961 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11776
eggNOG 1 0.900 - - E1_COG2023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560813at2759
OrthoFinder 1 1.000 - - FOG0006632
OrthoInspector 1 1.000 - - oto39026
orthoMCL 1 0.900 - - OOG6_103265
Panther 1 1.100 - - LDO PTHR14742
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1210
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.