DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and Rpp21

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001002831.1 Gene:Rpp21 / 406230 RGDID:1303090 Length:150 Species:Rattus norvegicus


Alignment Length:159 Identity:33/159 - (20%)
Similarity:58/159 - (36%) Gaps:52/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RAISSRMNYLFQASNLMAVGN--QPKLAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPLIPG 75
            |....|:|:|:||::.:...|  ...||.:|....:.:..:.::...|:|||:|||.|...||||
  Rat     8 REAFQRLNFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRTLCRDCSSLLIPG 72

  Fly    76 VNTELHVEEGAQEAKTDAQAQSNGAVKTKKKRHRRQRKKPRSRKTGNTNQEESEEQIQESTEQVS 140
            :...                             :|||::...|.|..|                 
  Rat    73 LTCT-----------------------------QRQRRRKGQRWTVQT----------------- 91

  Fly   141 FFLECSLCCGRRSFAANSQRDCWLEQPQS 169
                |..|...:.|..:.:...|.::|::
  Rat    92 ----CLTCQRSQRFLNDPKHLLWGDRPEA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 21/66 (32%)
Rpp21NP_001002831.1 Rpr2 13..96 CDD:397926 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560813at2759
OrthoFinder 1 1.000 - - FOG0006632
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103265
Panther 1 1.100 - - LDO PTHR14742
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.