DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and TRIM39-RPP21

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001186048.1 Gene:TRIM39-RPP21 / 202658 HGNCID:38845 Length:503 Species:Homo sapiens


Alignment Length:150 Identity:33/150 - (22%)
Similarity:59/150 - (39%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TQRAISSRMNYLFQASNLMAVGNQPK---LAAYYGKLCRNVGTKAIMHMAPAVKRSLCRRCFLPL 72
            |:...|.|..:..:|::.: :...|:   ||.:|....|.:..:.::...|:|||:|||.|...|
Human   355 TEGFTSGRHYWEVEAAHCV-LAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLL 418

  Fly    73 IPG-----------------------------VNTELHVEEGAQ-EAKTDAQAQSNGAVKTKKKR 107
            :||                             :|...|:..|.: ||:..:||.|..........
Human   419 VPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTA 483

  Fly   108 HRRQRKKP--RSRKTGNTNQ 125
            |....:.|  :.:..|::||
Human   484 HSISDRLPEEKMQTQGSSNQ 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 20/96 (21%)
TRIM39-RPP21NP_001186048.1 zf-C3HC4_4 29..69 CDD:291880
BBOX 106..143 CDD:237988
DUF2317 <136..228 CDD:302887
SPRY 305..>368 CDD:295394 3/12 (25%)
Rpr2 368..445 CDD:281961 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.