DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp21 and Y37E11B.6

DIOPT Version :9

Sequence 1:NP_001303571.1 Gene:Rpp21 / 318857 FlyBaseID:FBgn0053082 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_500380.1 Gene:Y37E11B.6 / 189625 WormBaseID:WBGene00021378 Length:136 Species:Caenorhabditis elegans


Alignment Length:133 Identity:30/133 - (22%)
Similarity:54/133 - (40%) Gaps:18/133 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DNKMKHLTQRAISSRMNYLFQA----SNLMAVGNQ--PKLAAYYGKLCRNVGTKAIMHMAPAVKR 62
            :|..|::..:...:|..:|.:.    |.|.:..|.  .|.:.:..||||.|....::|:....|:
 Worm    12 NNGKKNVKNKLGYARAEHLHRCAIFLSKLGSKNNDGFSKTSRHVSKLCRQVMDTEMVHLDCEQKQ 76

  Fly    63 SLCRRCFLPLIPGVNTELHVEEGAQEAKTDAQAQSNGAVKTKKKRHRRQRKKPRSRKTGNTNQEE 127
            ..|:.|...|:           |..| ||:...:..|:|..|.....::|........|.|.:|:
 Worm    77 QFCKICREVLV-----------GNYE-KTEISVKQRGSVTEKCGNCHKERNYMTKAGYGETLKEK 129

  Fly   128 SEE 130
            .|:
 Worm   130 LEK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp21NP_001303571.1 Rpr2 18..>83 CDD:281961 16/70 (23%)
Y37E11B.6NP_500380.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14742
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.