DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dtr and LRRC46

DIOPT Version :9

Sequence 1:NP_724335.2 Gene:dtr / 318856 FlyBaseID:FBgn0023090 Length:1483 Species:Drosophila melanogaster
Sequence 2:XP_005257832.1 Gene:LRRC46 / 90506 HGNCID:25047 Length:330 Species:Homo sapiens


Alignment Length:209 Identity:58/209 - (27%)
Similarity:88/209 - (42%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ELKCLWLECNAISEIQGLEKLSKLKCLFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTN 121
            ||:.:.|:...|:.|:.||.|..|..|:||.|.|.:||||.....|..|:|:.|.||:::|    
Human    54 ELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVEN---- 114

  Fly   122 VLPVLNTLTISSNYLKDSESLSDLIQCKTLSVLDLSNNRIDDILIVKIFEQMLNLKVLVLQGNPV 186
                                   |:....|..||||.|.|:.:   |:.|...:|.:|.|.||..
Human   115 -----------------------LLDLPCLQFLDLSENLIETL---KLDEFPQSLLILNLSGNSC 153

  Fly   187 VSRLPQYRKTLILACKELTYLDSRPVFPR------DRA-------------CAEAWKRDGYEGER 232
            .:: ..||:.:..|...|..||.:||..|      |.|             |:|.    |:..|.
Human   154 TNQ-DGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSER----GFLKEL 213

  Fly   233 KENNRWNRAERRKT 246
            ::....:|..|::|
Human   214 EQELSRHREHRQQT 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dtrNP_724335.2 leucine-rich repeat 38..57 CDD:275380 58/209 (28%)
LRR_8 56..112 CDD:290566 22/54 (41%)
LRR_4 56..98 CDD:289563 18/40 (45%)
LRR_RI 58..>184 CDD:238064 37/125 (30%)
leucine-rich repeat 58..79 CDD:275380 7/20 (35%)
leucine-rich repeat 80..101 CDD:275380 10/20 (50%)
LRR_8 100..161 CDD:290566 14/60 (23%)
leucine-rich repeat 102..125 CDD:275380 7/22 (32%)
leucine-rich repeat 126..147 CDD:275380 1/20 (5%)
leucine-rich repeat 151..175 CDD:275380 9/23 (39%)
LRRC46XP_005257832.1 LRR_8 54..109 CDD:290566 22/54 (41%)
leucine-rich repeat 55..76 CDD:275378 7/20 (35%)
LRR_4 75..115 CDD:289563 17/66 (26%)
leucine-rich repeat 77..98 CDD:275378 10/20 (50%)
LRR_8 97..151 CDD:290566 20/83 (24%)
LRR_4 97..135 CDD:289563 15/67 (22%)
leucine-rich repeat 99..120 CDD:275378 8/47 (17%)
leucine-rich repeat 121..142 CDD:275378 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.