Sequence 1: | NP_724335.2 | Gene: | dtr / 318856 | FlyBaseID: | FBgn0023090 | Length: | 1483 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015018.3 | Gene: | NUD1 / 854555 | SGDID: | S000005900 | Length: | 851 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 264 | Identity: | 70/264 - (26%) |
---|---|---|---|
Similarity: | 106/264 - (40%) | Gaps: | 56/264 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSNSNRKEITGLNRMTPKGLKELCKKDKLYQTPRLNDVLYLHYQGFQCIESL-EEYTELKCLWLE 64
Fly 65 CNAISEIQ-GLEKLSKLKCLFLQNNLI-TKIENLDPCRELDTLNLSSNHIRKIQNIGTNVLPVLN 127
Fly 128 TLTISSNYLKDSESLSDLIQCK--------TLSVLDLSNNRIDDILIVKIFEQMLNLKVLVLQGN 184
Fly 185 PVVS------------RLPQYRKTLILACKELTY-LDSRPVFPRDRACAEAWKRDGYEGERKENN 236
Fly 237 RWNR 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dtr | NP_724335.2 | leucine-rich repeat | 38..57 | CDD:275380 | 4/19 (21%) |
LRR_8 | 56..112 | CDD:290566 | 19/57 (33%) | ||
LRR_4 | 56..98 | CDD:289563 | 13/43 (30%) | ||
LRR_RI | 58..>184 | CDD:238064 | 43/135 (32%) | ||
leucine-rich repeat | 58..79 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 80..101 | CDD:275380 | 9/21 (43%) | ||
LRR_8 | 100..161 | CDD:290566 | 22/68 (32%) | ||
leucine-rich repeat | 102..125 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 126..147 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 151..175 | CDD:275380 | 9/23 (39%) | ||
NUD1 | NP_015018.3 | LRR | <440..662 | CDD:227223 | 58/203 (29%) |
leucine-rich repeat | 522..544 | CDD:275380 | 5/24 (21%) | ||
leucine-rich repeat | 545..567 | CDD:275380 | 9/21 (43%) | ||
PPP1R42 | 557..784 | CDD:411060 | 49/171 (29%) | ||
leucine-rich repeat | 568..588 | CDD:275380 | 8/19 (42%) | ||
leucine-rich repeat | 589..621 | CDD:275380 | 6/34 (18%) | ||
leucine-rich repeat | 622..643 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 699..738 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 739..768 | CDD:275380 | |||
leucine-rich repeat | 794..806 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4530 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |