DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dtr and CG13708

DIOPT Version :9

Sequence 1:NP_724335.2 Gene:dtr / 318856 FlyBaseID:FBgn0023090 Length:1483 Species:Drosophila melanogaster
Sequence 2:NP_001261433.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster


Alignment Length:423 Identity:88/423 - (20%)
Similarity:148/423 - (34%) Gaps:129/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYLHYQGFQCIESLEEYTELKCLWLECNAISEIQGLEKL-SKLKCLFLQNNLITKIENLDPC-RE 101
            |.|:....:.|.:|:....|..|.|..|.|::|.||..| ..|:.|.|..|.:|.:.:...| ::
  Fly   475 LDLYDNQIERIANLDGLPSLSVLLLGKNRITDIGGLSSLKDTLRVLDLHGNKLTSLGSRINCLQQ 539

  Fly   102 LDTLNLSSNHIRKIQNIGTNVLPVLNTLTISSNYLKDSESLSDLIQCKTLSVLDLSNNRIDDILI 166
            |.:|||:.|.||:|.......|..|..|.:..|.|:.......|:..:.|.:.....:|:||:..
  Fly   540 LKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQHLVALERLWLCHNDLHRVDDMAS 604

  Fly   167 VKIFEQMLNLKVLVLQGNPV----------VSRLPQYRKTLILACKELTYLDSRPVFPRDRACAE 221
            :....::|.   :.::.|||          ||.||.           |..|...|:..:.|..|.
  Fly   605 IARATRLLE---VTIENNPVSLAGDCVSFLVSYLPL-----------LQTLSQMPITEQVRRAAL 655

  Fly   222 AWKRDGYEGERKENNRWNRAERRKTRESINCTIRMRNSHRPPDQQDPLLRSSDSEDDTCAETARK 286
            ||::                                  |:...|..|  .||::           
  Fly   656 AWRQ----------------------------------HKEQAQAAP--GSSEA----------- 673

  Fly   287 KVALENGCVDDLWEEVSGEQPISEDGTNSSSSLEDNDGTSSQDDLIAEKLSNRRTLEGRPTVLYE 351
                        :..:..|:.||...||                  .|.|.:::|:.|||.....
  Fly   674 ------------YHNIRREEVISNARTN------------------WELLRSQQTVVGRPKSRLT 708

  Fly   352 TEVSNVKSANNDINIFEEGVGKASQIIIEDKPVTKIKLINEPSCMNDKSAMNCTSMGPVVKE--N 414
            :|::.:..:|      |...|:..::..|:....|       ..|::..|:  ..:.|:.|:  |
  Fly   709 SELAKINESN------EGPAGEEGEMESEESQQPK-------ELMDELQAL--IKLPPIAKDLRN 758

  Fly   415 DFDEDAEIK-------NVDDMVPCQNLIKSNED 440
            ..:||....       |||....|.:  ..|||
  Fly   759 PHEEDGASSEASSLGPNVDSCSSCYS--SDNED 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dtrNP_724335.2 leucine-rich repeat 38..57 CDD:275380 4/17 (24%)
LRR_8 56..112 CDD:290566 20/57 (35%)
LRR_4 56..98 CDD:289563 14/42 (33%)
LRR_RI 58..>184 CDD:238064 34/127 (27%)
leucine-rich repeat 58..79 CDD:275380 9/21 (43%)
leucine-rich repeat 80..101 CDD:275380 6/21 (29%)
LRR_8 100..161 CDD:290566 15/60 (25%)
leucine-rich repeat 102..125 CDD:275380 9/22 (41%)
leucine-rich repeat 126..147 CDD:275380 5/20 (25%)
leucine-rich repeat 151..175 CDD:275380 4/23 (17%)
CG13708NP_001261433.1 LRR_RI <428..572 CDD:238064 30/96 (31%)
leucine-rich repeat 449..471 CDD:275380
leucine-rich repeat 472..493 CDD:275380 4/17 (24%)
LRR_8 475..527 CDD:290566 17/51 (33%)
leucine-rich repeat 494..516 CDD:275380 9/21 (43%)
LRR_8 516..574 CDD:290566 18/57 (32%)
leucine-rich repeat 517..539 CDD:275380 6/21 (29%)
leucine-rich repeat 540..563 CDD:275380 9/22 (41%)
LRR_4 564..604 CDD:289563 9/39 (23%)
leucine-rich repeat 564..585 CDD:275380 5/20 (25%)
leucine-rich repeat 611..637 CDD:275380 7/28 (25%)
LRR_9 <1059..1153 CDD:258718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.