DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and H2ax

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001102761.1 Gene:H2ax / 500987 RGDID:1566119 Length:143 Species:Rattus norvegicus


Alignment Length:121 Identity:110/121 - (90%)
Similarity:116/121 - (95%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.||||||:||||||||||:|||||||:||||||||||||||||:|||.||:||
  Rat     1 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            |||||||||||||||||||||||||||||||||.||||||||||||||||||||||
  Rat    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 98/105 (93%)
H2axNP_001102761.1 PTZ00017 1..130 CDD:185399 110/121 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4453
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D607367at33208
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9107
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.