DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and h2az2a

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_005165093.1 Gene:h2az2a / 252913 ZFINID:ZDB-GENE-020717-1 Length:137 Species:Danio rerio


Alignment Length:112 Identity:72/112 - (64%)
Similarity:82/112 - (73%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK----SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAA 60
            |:| ||.||..||||    |||.|||||||||||||.|:....:. ||||.|.||.||::|||.|
Zfish     1 MAG-GKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTA 64

  Fly    61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGV 107
            |||||||||::|.|..||.|||||||||.||||:.|:. .|||.||:
Zfish    65 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGM 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 62/93 (67%)
h2az2aXP_005165093.1 H2A 8..109 CDD:238029 65/101 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.