DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG31618 and htz-1

DIOPT Version :9

Sequence 1:NP_724343.1 Gene:His2A:CG31618 / 318855 FlyBaseID:FBgn0051618 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_500569.1 Gene:htz-1 / 177212 WormBaseID:WBGene00019947 Length:140 Species:Caenorhabditis elegans


Alignment Length:122 Identity:75/122 - (61%)
Similarity:89/122 - (72%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRGKGGKVKGKAK----SRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEV 62
            |:||.||..||:|    |||.|||||||||||||.|::...:. ||||.|.||.||::|||.|||
 Worm     4 GKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEV 68

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            |||||||::|.|..||.||||.||||.||||:.|:. .|||.|||:|:|...|:.||
 Worm    69 LELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIK-ATIAGGGVIPHIHRYLMNKK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG31618NP_724343.1 PTZ00017 16..124 CDD:185399 67/105 (64%)
htz-1NP_500569.1 PTZ00017 3..135 CDD:185399 75/122 (61%)
H2A 10..124 CDD:238029 69/114 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.