DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG31617 and His1:CG33861

DIOPT Version :9

Sequence 1:NP_724341.1 Gene:His1:CG31617 / 318854 FlyBaseID:FBgn0051617 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027379.1 Gene:His1:CG33861 / 3771736 FlyBaseID:FBgn0053861 Length:256 Species:Drosophila melanogaster


Alignment Length:256 Identity:255/256 - (99%)
Similarity:256/256 - (100%) Gaps:0/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65

  Fly    66 SSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAK 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 SSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAK 130

  Fly   131 SKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTG 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 SKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTG 195

  Fly   196 IIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAKK 256
            |||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||
  Fly   196 IIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAKK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG31617NP_724341.1 Linker_histone 46..118 CDD:278939 71/71 (100%)
His1:CG33861NP_001027379.1 Linker_histone 46..118 CDD:278939 71/71 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469880
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I2109
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D135390at33392
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm6549
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
1110.730

Return to query results.
Submit another query.