DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG31617 and LOC101730806

DIOPT Version :9

Sequence 1:NP_724341.1 Gene:His1:CG31617 / 318854 FlyBaseID:FBgn0051617 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004919325.2 Gene:LOC101730806 / 101730806 -ID:- Length:203 Species:Xenopus tropicalis


Alignment Length:261 Identity:95/261 - (36%)
Similarity:122/261 - (46%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |:::|..|..:|   |||...||..|.|.:.:.|.||||    ||.|...:::..::...|||.|
 Frog     1 MAETAAETVPAP---PPAEAAKKKKQPKKAAAGGAKAKK----PSGPSAAELIVKAVSASKERSG 58

  Fly    66 SSLLAIKKYITA-TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.| .|  |.::....:|..||:.|..|.|.|.||.||||||||:           
 Frog    59 VSLAALKKALAAGGY--DVERNNSRLKLALKALVTKGTLTQVKGSGASGSFKLN----------- 110

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEK---AKAKDA 191
                   :|.::||:.|:|      ||.|.      |||||..|.||..::.|..|   |.||..
 Frog   111 -------KKPLESKEKAAK------KKPAA------PKAKKPAAAKKAPKSPKKPKKVSAAAKSP 156

  Fly   192 KKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK-ASVSATAKKPKAKTTAAK 255
            ||.    .|||  ||..:..||||             |||||..|. |..:|..|..|||..|.|
 Frog   157 KKV----KKPA--KAAKSPKKPKA-------------AKPKKVAKSPAKKAAKPKAAKAKKAAPK 202

  Fly   256 K 256
            |
 Frog   203 K 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG31617NP_724341.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
LOC101730806XP_004919325.2 Linker_histone 40..110 CDD:366156 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.