DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG31613 and HHT1

DIOPT Version :9

Sequence 1:NP_724345.1 Gene:His3:CG31613 / 318847 FlyBaseID:FBgn0051613 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_009564.1 Gene:HHT1 / 852295 SGDID:S000000214 Length:136 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:121/136 - (88%)
Similarity:130/136 - (95%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||||||||||||||:||||||||:||||||||||:|||||||||||:||||||||||
Yeast     1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||||:.||||:.|||||.|||||||.|||||||||..|||:||||
Yeast    66 LPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARR 130

  Fly   131 IRGERA 136
            :||||:
Yeast   131 LRGERS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG31613NP_724345.1 PTZ00018 1..136 CDD:185400 120/134 (90%)
HHT1NP_009564.1 PTZ00018 1..136 CDD:185400 120/134 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I393
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I685
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - otm46875
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.