DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG31613 and H3f3c

DIOPT Version :10

Sequence 1:NP_724345.1 Gene:His3:CG31613 / 318847 FlyBaseID:FBgn0051613 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001357860.1 Gene:H3f3c / 625328 MGIID:3650546 Length:136 Species:Mus musculus


Alignment Length:136 Identity:130/136 - (95%)
Similarity:133/136 - (97%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||.||||||||||||||||||||||.|||||:|||||||||||||||||||||||||||||||||
Mouse     1 MALTKQTARKSTGGKAPRKQLATKATRKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||||||||
Mouse    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
Mouse   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG31613NP_724345.1 PTZ00018 1..136 CDD:185400 128/134 (96%)
H3f3cNP_001357860.1 PTZ00018 1..136 CDD:185400 128/134 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 39/42 (93%)

Return to query results.
Submit another query.