DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG31613 and hht3

DIOPT Version :9

Sequence 1:NP_724345.1 Gene:His3:CG31613 / 318847 FlyBaseID:FBgn0051613 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_596467.1 Gene:hht3 / 2539804 PomBaseID:SPBC1105.11c Length:136 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:125/136 - (91%)
Similarity:131/136 - (96%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||||||||||||||:|||||:||||||||||||||||||||||||||||||||||||
pombe     1 MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||||:.|||||.|||||.|||||||||||.|||||.|||:|||||
pombe    66 LPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTIQPKDMQLARR 130

  Fly   131 IRGERA 136
            :||||:
pombe   131 LRGERS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG31613NP_724345.1 PTZ00018 1..136 CDD:185400 124/134 (93%)
hht3NP_596467.1 PTZ00018 1..136 CDD:185400 124/134 (93%)
Histone 1..132 CDD:278551 121/130 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 242 1.000 Domainoid score I445
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 249 1.000 Inparanoid score I791
OMA 1 1.010 - - QHG54047
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - mtm9313
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.