DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG31613 and his-74

DIOPT Version :9

Sequence 1:NP_724345.1 Gene:His3:CG31613 / 318847 FlyBaseID:FBgn0051613 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_506164.1 Gene:his-74 / 179734 WormBaseID:WBGene00012276 Length:136 Species:Caenorhabditis elegans


Alignment Length:136 Identity:124/136 - (91%)
Similarity:130/136 - (95%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||.||||||||||..||.|||.||:||||||||||||||||||||:||
 Worm     1 MARTKQTARKSTGGKAPRKALATKAARKSAIVTGSVKKVHRFRPGTVALREIRRYQKSTELLLRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||:|||||
 Worm    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARR 130

  Fly   131 IRGERA 136
            |||||:
 Worm   131 IRGERS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG31613NP_724345.1 PTZ00018 1..136 CDD:185400 123/134 (92%)
his-74NP_506164.1 PTZ00018 1..136 CDD:185400 123/134 (92%)
Histone 1..132 CDD:278551 119/130 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 1 1.010 - - D476949at33208
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.