DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG31611 and H4C12

DIOPT Version :9

Sequence 1:NP_724344.1 Gene:His4:CG31611 / 318846 FlyBaseID:FBgn0051611 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_003532.1 Gene:H4C12 / 8362 HGNCID:4784 Length:103 Species:Homo sapiens


Alignment Length:103 Identity:102/103 - (99%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||||||||||||||||||||||||||||
Human    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG31611NP_724344.1 PLN00035 1..103 CDD:177669 100/101 (99%)
H4C12NP_003532.1 PLN00035 1..103 CDD:177669 100/101 (99%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 17/18 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5676
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3736
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53718
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto90862
orthoMCL 1 0.900 - - OOG6_100120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R544
SonicParanoid 1 1.000 - - X2948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.