DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG31611 and AT5G59970

DIOPT Version :9

Sequence 1:NP_724344.1 Gene:His4:CG31611 / 318846 FlyBaseID:FBgn0051611 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001332089.1 Gene:AT5G59970 / 836119 AraportID:AT5G59970 Length:103 Species:Arabidopsis thaliana


Alignment Length:103 Identity:100/103 - (97%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
plant     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||:|||||||||||||||||||||||||
plant    66 VIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG31611NP_724344.1 PLN00035 1..103 CDD:177669 98/101 (97%)
AT5G59970NP_001332089.1 PLN00035 1..103 CDD:177669 98/101 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1919
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I1301
OMA 1 1.010 - - QHG53718
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto3475
orthoMCL 1 0.900 - - OOG6_100120
Panther 1 1.100 - - LDO PTHR10484
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.