DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG31611 and hhf1

DIOPT Version :9

Sequence 1:NP_724344.1 Gene:His4:CG31611 / 318846 FlyBaseID:FBgn0051611 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_594682.1 Gene:hhf1 / 2542463 PomBaseID:SPAC1834.03c Length:103 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:93/103 - (90%)
Similarity:101/103 - (98%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||:||||||||||||||||||||||||||.|:|||||.|||:||||
pombe     1 MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISALVYEETRAVLKLFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||||||||::||||:|||||||:|||||
pombe    66 VIRDAVTYTEHAKRKTVTSLDVVYSLKRQGRTIYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG31611NP_724344.1 PLN00035 1..103 CDD:177669 91/101 (90%)
hhf1NP_594682.1 H4 18..101 CDD:238031 73/82 (89%)
PTZ00015 18..101 CDD:185397 73/82 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I1567
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1031
OMA 1 1.010 - - QHG53718
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto101715
orthoMCL 1 0.900 - - OOG6_100120
Panther 1 1.100 - - LDO PTHR10484
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R544
SonicParanoid 1 1.000 - - X2948
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.