DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG31611 and si:ch73-368j24.1

DIOPT Version :9

Sequence 1:NP_724344.1 Gene:His4:CG31611 / 318846 FlyBaseID:FBgn0051611 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_021333353.1 Gene:si:ch73-368j24.1 / 108190620 ZFINID:ZDB-GENE-160113-131 Length:94 Species:Danio rerio


Alignment Length:92 Identity:79/92 - (85%)
Similarity:82/92 - (89%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEH 76
            |.|..:|.|.|||||:.||||.|||||||||||||||||||.|||.||||||.||||||||||||
Zfish     3 GVGKRQRCRMVLRDNLHGITKTAIRRLARRGGVKRISGLIYGETRDVLKVFLTNVIRDAVTYTEH 67

  Fly    77 AKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||:||||||||||||||||||
Zfish    68 AKRKTVTAIDVVYALKRQGRTLYGFGG 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG31611NP_724344.1 PLN00035 1..103 CDD:177669 77/90 (86%)
si:ch73-368j24.1XP_021333353.1 PTZ00015 1..92 CDD:185397 75/88 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10484
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.