DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG31611 and LOC101733182

DIOPT Version :9

Sequence 1:NP_724344.1 Gene:His4:CG31611 / 318846 FlyBaseID:FBgn0051611 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_004917044.1 Gene:LOC101733182 / 101733182 -ID:- Length:103 Species:Xenopus tropicalis


Alignment Length:103 Identity:102/103 - (99%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||||||||||||||||||||||||||||
 Frog    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG31611NP_724344.1 PLN00035 1..103 CDD:177669 100/101 (99%)
LOC101733182XP_004917044.1 PLN00035 1..103 CDD:177669 100/101 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3634
OMA 1 1.010 - - QHG53718
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto104650
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R544
SonicParanoid 1 1.000 - - X2948
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.