DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and WFDC8

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:54 Identity:18/54 - (33%)
Similarity:24/54 - (44%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |..|......|.|:...:.|.:|:...||..|.|.||.||.|.|..::.|...|
Human    92 QEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 16/49 (33%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672
KU 93..145 CDD:197529 16/51 (31%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.