DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and TFPI2

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:107 Identity:34/107 - (31%)
Similarity:49/107 - (45%) Gaps:11/107 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIFLLFLYPVVAVVPQGFTIKQPK------CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCG 65
            :|.||||.....    |...::|.      |....:.|||...:..:.||..|..|..|.||||.
Human    10 SILLLFLTEAAL----GDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCE 70

  Fly    66 GNPNRFYTKEECLKTC-RVYRPPNRKKREENLDEEEEEEFEE 106
            ||.|.|||.|.|...| |:.:.|...:.:.::|::.|...|:
Human    71 GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/49 (43%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659 22/55 (40%)
Kunitz_BPTI 95..149 CDD:425421 3/18 (17%)
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.