DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and paplna

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:61 Identity:24/61 - (39%)
Similarity:33/61 - (54%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |...|.:...|......||||.:...:.:|...:||:.|:||||.||.|.|.::|||.|.|
Zfish   710 PPSNTQRSLSCDLPNTVGPCDQWTSRFYFDRSASRCLHFWYGGCHGNSNNFASEEECQKMC 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/49 (43%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAMTS_CR_3 80..177 CDD:437068
ADAMTS_spacer1 181..293 CDD:461796
TSP1_ADAMTS 303..355 CDD:465950
TSP1_ADAMTS 385..442 CDD:465950
TSP1_ADAMTS 450..498 CDD:465950
TSP1_ADAMTS 504..557 CDD:465950
Kunitz_papilin 720..770 CDD:438678 21/49 (43%)
Ig_3 839..906 CDD:464046
Ig 959..1034 CDD:472250
Ig strand B 963..967 CDD:409353
Ig strand C 979..983 CDD:409353
Ig strand E 1000..1004 CDD:409353
Ig strand F 1014..1019 CDD:409353
Ig strand G 1027..1030 CDD:409353
Ig 1039..1121 CDD:472250
Ig strand B 1055..1059 CDD:409353
Ig strand C 1067..1071 CDD:409353
Ig strand E 1090..1094 CDD:409353
Ig strand F 1104..1109 CDD:409353
Ig strand G 1115..1118 CDD:409353
PLAC 1142..1173 CDD:462560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.