DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and spint2

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:89 Identity:25/89 - (28%)
Similarity:44/89 - (49%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVVAVVPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLK 79
            ||:..:|:.....:.||...::.|||....:::.::..:..|..|.||||.||.||:.::|||:.
Zfish   288 PVIPAIPKSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMS 352

  Fly    80 TCRVYRPPNRKKREENLDEEEEEE 103
            .|        ..::...||...|:
Zfish   353 VC--------STKDGRFDEHGHEK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.