DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG17380

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:56/103 - (54%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLFLYPVVAVVPQGFT-IKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFY 72
            ||:||     :||...| ::..:|.::||||||....:::.||...|.|:.|.|||||||||||.
  Fly     7 FLIFL-----IVPGTSTALRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQ 66

  Fly    73 TKEECLKTCR----------VYRPPNRKKREENLDEEE 100
            ||:||:..|.          ||...|.::..:....||
  Fly    67 TKKECILLCNALADEDEYLIVYTDKNEQQITDGTMSEE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 27/49 (55%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 27/49 (55%)

Return to query results.
Submit another query.