DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG14298

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:57 Identity:22/57 - (38%)
Similarity:26/57 - (45%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CWYVANPGP-CD--DFVKV---WGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |:...|.|. |.  |..||   |.:|  ...|..|.|.||.||.|||.::|.|...|
  Fly    55 CYVGRNEGNFCSRKDQTKVVTRWYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/55 (38%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/36 (39%)

Return to query results.
Submit another query.