DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and spint1a

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:75 Identity:22/75 - (29%)
Similarity:32/75 - (42%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRVYRPPNRK 90
            :.:.:|......|.|......|.|:.....|..|.||||.||.|||.|:..|:..|......::.
Zfish   380 VSKARCVKPPVTGTCPGSQTKWYYNPNKRLCYRFNYGGCEGNQNRFETEAGCMTFCSGVTENDKF 444

  Fly    91 KREENLDEEE 100
            ..|...|::|
Zfish   445 PEESQFDKQE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 18/49 (37%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.