DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and CG13748

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:61 Identity:21/61 - (34%)
Similarity:30/61 - (49%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTC 81
            |:.|      |...|..|.|...:..|.||....:|:.|.:|||.||.|.|.:.::|:.||
  Fly    56 PEQF------CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/60 (33%)

Return to query results.
Submit another query.