DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31609 and K12G11.6

DIOPT Version :10

Sequence 1:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001024057.2 Gene:K12G11.6 / 3565780 WormBaseID:WBGene00010792 Length:186 Species:Caenorhabditis elegans


Alignment Length:53 Identity:20/53 - (37%)
Similarity:24/53 - (45%) Gaps:7/53 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCR 82
            ||      |.....:|.: :|.....|:.|.|.|||||.|||...|.|...||
 Worm    30 KC------GKAQKSIKYY-FDKKLEMCLPFLYSGCGGNTNRFDDSEMCNLRCR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)
K12G11.6NP_001024057.2 KU 20..74 CDD:197529 18/50 (36%)

Return to query results.
Submit another query.